Loading...
Statistics
Advertisement

BUSINESS-TAXI-COLOGNE - Taxi Köln - Grossraumtaxi ...
www.taxi24-koeln.de/
Ihr Taxiunternehmen in Köln das auf Flughafentransfer spezialisiert ist.Cologne's Business Taxi Company - If you need a Taxi call: 0049 177 24 13 834

Taxi24-koeln.de

Advertisement
Conversion Technology Metas Server
Taxi24-koeln.de is hosted in Germany . Taxi24-koeln.de doesn't use HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Taxi24-koeln.de

Technology

Number of occurences: 1
  • Html

Advertisement

Server Type

  • Apache

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Taxi24-koeln.de

Missing HTTPS protocol.

    Meta - Taxi24-koeln.de

    Number of occurences: 8
    • Name: Description
      Content: Ihr Taxiunternehmen in Köln das auf Flughafentransfer spezialisiert ist.Cologne's Business Taxi Company - If you need a Taxi call: 0049 177 24 13 834
    • Name: KeyWords
      Content: Taxi,Taxis,Köln,Flughafen,Flughafetransfer,Airportshuttle,Airport,Cab,Cologne,Service,Grossraumtaxi,Hochzeitsfahrten,Taxibus,Kurierdienst,Reisen,Ausflüge,Clubfahrten,Shuttleservice,Hotelfahrten,Hotel,transportation,Limousinen,Chauffeur,Chauffeurdienst,Düsseldorf,Personenbeförderung,reservations,reservation,telefon,unternehmen,help,hilfe
    • Name: LANGUAGE
      Content: de
    • Name: ALIAS
      Content: http://www.business-taxi-cologne.de
    • Name: OWNER
      Content: info@business-taxi-cologne.de
    • Name:
      Content: text/html; charset=windows-1252
    • Name: Taxi, Business, Köln, Flughafen, Transfer, Verkehr, Stadtrundfahrt,Hochzeitsfahrten, Reisen, München, Hamburg, Berlin, Fahrdienste, Mercedes, Limousinen, Großraum
      Content: Microsoft FrontPage 5.0
    • Name: Taxi, Business, Köln, Flughafen, Transfer, Verkehr, Stadtrundfahrt, Reisen, München, Hamburg, Berlin, Fahrdienste, Mercedes, Limousinen, Großraum
      Content: FrontPage.Editor.Document

    Server / Hosting

    • IP: 217.160.231.154
    • Latitude: 51.30
    • Longitude: 9.49
    • Country: Germany

    Rname

    • ns9.schlund.de
    • ns10.schlund.de
    • mx00.schlund.de
    • mx01.schlund.de

    Target

    • hostmaster.schlund.de

    HTTP Header Response

    HTTP/1.1 200 OK Content-Type: text/html Content-Length: 1988 Date: Wed, 31 Aug 2016 12:58:38 GMT Server: Apache Last-Modified: Thu, 12 May 2005 17:32:05 GMT ETag: "7c4-3f6ec2b0b2f40" Accept-Ranges: bytes X-Cache: MISS from s_mf40 X-Cache-Lookup: MISS from s_mf40:80 Via: 1.1 s_mf40 (squid/3.5.20) Connection: keep-alive

    DNS

    host: taxi24-koeln.de
    1. class: IN
    2. ttl: 3600
    3. type: A
    4. ip: 217.160.231.154
    host: taxi24-koeln.de
    1. class: IN
    2. ttl: 172800
    3. type: NS
    4. target: ns9.schlund.de
    host: taxi24-koeln.de
    1. class: IN
    2. ttl: 172800
    3. type: NS
    4. target: ns10.schlund.de
    host: taxi24-koeln.de
    1. class: IN
    2. ttl: 86400
    3. type: SOA
    4. mname: ns9.schlund.de
    5. rname: hostmaster.schlund.de
    6. serial: 2016041900
    7. refresh: 28800
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 1800
    host: taxi24-koeln.de
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mx00.schlund.de
    host: taxi24-koeln.de
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mx01.schlund.de

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.axi24-koeln.de, www.tqaxi24-koeln.de, www.qaxi24-koeln.de, www.taaxi24-koeln.de, www.aaxi24-koeln.de, www.t axi24-koeln.de, www. axi24-koeln.de, www.twaxi24-koeln.de, www.waxi24-koeln.de, www.teaxi24-koeln.de, www.eaxi24-koeln.de, www.tzaxi24-koeln.de, www.zaxi24-koeln.de, www.txaxi24-koeln.de, www.xaxi24-koeln.de, www.tcaxi24-koeln.de, www.caxi24-koeln.de, www.txi24-koeln.de, www.taoxi24-koeln.de, www.toxi24-koeln.de, www.tapxi24-koeln.de, www.tpxi24-koeln.de, www.ta9xi24-koeln.de, www.t9xi24-koeln.de, www.taxi24-koeln.de, www.txi24-koeln.de, www.taixi24-koeln.de, www.tixi24-koeln.de, www.tauxi24-koeln.de, www.tuxi24-koeln.de, www.tai24-koeln.de, www.taxqi24-koeln.de, www.taqi24-koeln.de, www.taxi24-koeln.de, www.tai24-koeln.de, www.taxai24-koeln.de, www.taai24-koeln.de, www.taxsi24-koeln.de, www.tasi24-koeln.de, www.taxdi24-koeln.de, www.tadi24-koeln.de, www.taxei24-koeln.de, www.taei24-koeln.de, www.tax24-koeln.de, www.taxir24-koeln.de, www.taxr24-koeln.de, www.taxif24-koeln.de, www.taxf24-koeln.de, www.taxiv24-koeln.de, www.taxv24-koeln.de, www.taxik24-koeln.de, www.taxk24-koeln.de, www.taxi,24-koeln.de, www.tax,24-koeln.de, www.taxib24-koeln.de, www.taxb24-koeln.de, www.taxig24-koeln.de, www.taxg24-koeln.de, www.taxit24-koeln.de, www.taxt24-koeln.de, www.taxiy24-koeln.de, www.taxy24-koeln.de, www.taxiu24-koeln.de, www.taxu24-koeln.de, www.taxij24-koeln.de, www.taxj24-koeln.de, www.taxim24-koeln.de, www.taxm24-koeln.de, www.taxin24-koeln.de, www.taxn24-koeln.de, www.taxi4-koeln.de, www.taxi204-koeln.de, www.taxi04-koeln.de, www.taxi2q4-koeln.de, www.taxiq4-koeln.de, www.taxi2w4-koeln.de, www.taxiw4-koeln.de, www.taxi2-koeln.de, www.taxi24w-koeln.de, www.taxi2w-koeln.de, www.taxi24q-koeln.de, www.taxi2q-koeln.de, www.taxi24t-koeln.de, www.taxi2t-koeln.de, www.taxi24e-koeln.de, www.taxi2e-koeln.de, www.taxi24r-koeln.de, www.taxi2r-koeln.de, www.taxi242-koeln.de, www.taxi22-koeln.de, www.taxi24koeln.de, www.taxi24-tkoeln.de, www.taxi24tkoeln.de, www.taxi24-gkoeln.de, www.taxi24gkoeln.de, www.taxi24-hkoeln.de, www.taxi24hkoeln.de, www.taxi24-ukoeln.de, www.taxi24ukoeln.de, www.taxi24-jkoeln.de, www.taxi24jkoeln.de, www.taxi24-xkoeln.de, www.taxi24xkoeln.de, www.taxi24-skoeln.de, www.taxi24skoeln.de, www.taxi24-akoeln.de, www.taxi24akoeln.de, www.taxi24-koeln.de, www.taxi24koeln.de, www.taxi24- koeln.de, www.taxi24 koeln.de, www.taxi24-oeln.de, www.taxi24-ktoeln.de, www.taxi24-toeln.de, www.taxi24-koeln.de, www.taxi24-oeln.de, www.taxi24-kgoeln.de, www.taxi24-goeln.de, www.taxi24-kboeln.de, www.taxi24-boeln.de, www.taxi24-knoeln.de, www.taxi24-noeln.de, www.taxi24-khoeln.de, www.taxi24-hoeln.de, www.taxi24-kyoeln.de, www.taxi24-yoeln.de, www.taxi24-kloeln.de, www.taxi24-loeln.de, www.taxi24-kooeln.de, www.taxi24-ooeln.de, www.taxi24-kuoeln.de, www.taxi24-uoeln.de, www.taxi24-kioeln.de, www.taxi24-ioeln.de, www.taxi24-kmoeln.de, www.taxi24-moeln.de, www.taxi24-keln.de, www.taxi24-kobeln.de, www.taxi24-kbeln.de, www.taxi24-koheln.de, www.taxi24-kheln.de, www.taxi24-kogeln.de, www.taxi24-kgeln.de, www.taxi24-kojeln.de, www.taxi24-kjeln.de, www.taxi24-komeln.de, www.taxi24-kmeln.de, www.taxi24-ko eln.de, www.taxi24-k eln.de, www.taxi24-koveln.de, www.taxi24-kveln.de, www.taxi24-koln.de, www.taxi24-koexln.de, www.taxi24-koxln.de, www.taxi24-koesln.de, www.taxi24-kosln.de, www.taxi24-koewln.de, www.taxi24-kowln.de, www.taxi24-koerln.de, www.taxi24-korln.de, www.taxi24-koefln.de, www.taxi24-kofln.de, www.taxi24-koevln.de, www.taxi24-kovln.de, www.taxi24-koecln.de, www.taxi24-kocln.de, www.taxi24-koeqln.de, www.taxi24-koqln.de, www.taxi24-koealn.de, www.taxi24-koaln.de, www.taxi24-koeyln.de, www.taxi24-koyln.de,

    Other websites we recently analyzed

    1. meada.com
      Switzerland - 141.8.224.25
      Server software: Apache
      Technology: Google Adsense, CSS, Html, Javascript, Php
      Number of Javascript: 4
      Number of meta tags: 2
    2. melonella.com
      Dublin (Ireland) - 46.137.111.230
      Server software: Apache/2.2.22 (Ubuntu)
      Technology: Html
    3. Klettertreff.org
      Herzfond
      Austria - 84.116.32.65
      Server software: Apache
      Technology: Html
      Number of meta tags: 4
    4. kasimpasalikemalefendivakfi.info | Isimtescil.net | Ücretsiz yapım aşamasında sayfası
      Cyprus - 93.89.226.17
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html
    5. www.aarhusdesignbureau.dk
      Denmark - 77.66.85.131
      Server software: Apache-Coyote/1.1
      Technology: Html
      Number of meta tags: 1
    6. CNC-Bertschinger AG - Präzisionsmechanik
      Jules Bertschinger AG, Präzisionsmechanik, CNC-Bearbeitung, Werkzeug- und Formenbau
      Switzerland - 217.196.177.100
      Server software: nginx
      Technology: Html, Javascript, jQuery UI, Php, Xoops
      Number of Javascript: 9
      Number of meta tags: 8
    7. Riverside Haj
      Riverside Haj
      San Francisco (United States) - 192.241.212.155
      G Analytics ID: UA-51322866-1
      Server software: nginx/1.4.6 (Ubuntu)
      Technology: Carousel, CSS, Html, Html5, Iframe, Javascript, jQuery, Google Analytics
      Number of Javascript: 13
      Number of meta tags: 5
    8. www.newrf.ru/ - Сервис регистрации доменов и хостинга *.RU-TLD.RU
      France - 37.187.83.72
      Server software: nginx
      Technology: CSS, Google Font API, Html, Javascript, Shortcodes, Yandex.Metrika, Wordpress
      Number of Javascript: 1
      Number of meta tags: 1
    9. Campus-Management von CampusCore
      Germany - 217.194.229.17
      Server software: Apache/2.2.0 (Fedora)
      Technology: Carousel, CSS, Google Font API, Html, Html5, jQuery Cycle
      Number of Javascript: 10
      Number of meta tags: 1
    10. Liikelahjat | mainoslahjat | mainostekstiilit | - Matin Sakki
      Liikelahjat,mainoslahjat sekä mainostekstiilit 30 vuoden kokemuksella. Tehtävämme on auttaa sinua rakentamaan kestäviä asiakassuhteita.
      Finland - 84.34.147.48
      Server software: Apache/2
      Technology: CSS, Google Font API, Html, Javascript, Php, Google Analytics, Prestashop
      Number of Javascript: 25
      Number of meta tags: 7

    Check Other Websites